




LL-37 5mg(Cathelicidin)
Nie udało się załadować dostępności odbioru
Premium Grade | UK Supply | Research Peptide | COA Certified | >99% Purity | Worldwide Delivery
LL-37 is a peptide research compound studied in laboratory settings for its relevance to host defence peptide biology, innate response pathways, and controlled sequence based investigation. It is commonly examined in structured research models focused on membrane interaction patterns, biochemical signalling behaviour, and comparative peptide mechanism analysis under defined laboratory conditions. Within scientific supply catalogues, LL-37 is valued for in vitro and preclinical research involving pathway observation, marker evaluation, and analytical peptide study design.
Technical Specifications
- Contents: 5mg LL-37
- Form: Lyophilized powder
- Purity: >99% (HPLC Verified)
- Storage: Store between 2°C and 8°C
- Molecular Formula: C₂₁₅H₃₄₄N₆₀O₅₀
- Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
- Peptide Length: 37 Amino-Acids
- pH Range: 5.5-7.4
Note: Reconstitute with Bacteriostatic (BAC) water for best results.
Related Research Compounds
Mot-c 10mg
ACE-031 1mg
GHK-cu 100mg
Disclaimer

Pay With "Wise"
Set Up Wise Here-Works Just Like PayPal. Just Add Your card And Pay In Minutes... Great For International Payments!
Your Recently Viewed Products...
Take another look at recently viewed products and continue exploring the BioPlex range.
New Research Arrivals & Liquid Amino-Acid Blends
Product Information
Specifications, shipping & research guidelines
Laboratory Research Use
This product is supplied for laboratory research and analytical purposes only, supporting structured investigation within controlled scientific environments.
Product Specifications
Form: Lyophilised powder
Purity: >99% (HPLC Verified)
Storage: 2°C to 8°C
Shipping Information
UK 24hr shipping Worldwide 48hr Shipping via DHL Express. Orders are dispatched Monday to Thursday using tracked delivery services.
Latest Articles From BioPlex ...
Research insights, industry updates and practical guidance from BioPlex Peptides.














