LL-37 5mg(Cathelicidin)
Teslim alım stok durumu yüklenemedi
Premium Grade | UK Supply | Research Peptide | COA Certified | >99% Purity | Worldwide Delivery
(Heptatriacontapeptide–37 Amino Acids)
Brief Summary
LL-37 is a peptide research compound studied in laboratory settings for its relevance to host defence peptide biology, innate response pathways, and controlled sequence based investigation. It is commonly examined in structured research models focused on membrane interaction patterns, biochemical signalling behaviour, and comparative peptide mechanism analysis under defined laboratory conditions. Within scientific supply catalogues, LL-37 is valued for in vitro and preclinical research involving pathway observation, marker evaluation, and analytical peptide study design.
Product Overview
LL37 is a cationic host defence peptide examined extensively in laboratory research for its role in innate immune signalling membrane interaction dynamics and cellular communication processes. It is derived from the C terminal region of the human cathelicidin antimicrobial protein and is studied for its ability to interact with lipid membranes nucleic acids and intracellular signalling systems. Due to its amphipathic structure and well defined molecular behaviour LL37 serves as a key research tool for investigating peptide mediated immune signalling barrier function and cellular response coordination within controlled experimental models.
Scientific Background
From a molecular science perspective LL37 is characterised by its alpha helical structure and positive charge distribution which facilitate interaction with negatively charged membrane components. Research focuses on how LL37 associates with phospholipid bilayers modulates membrane permeability and influences intracellular signalling cascades following membrane engagement. LL37 is also studied for its interaction with nucleic acid complexes and pattern recognition receptor pathways which contribute to immune signal modulation and transcriptional response regulation. These properties allow researchers to examine peptide driven signalling integration membrane associated communication and innate immune pathway coordination at the cellular level.
Research Applications
LL37 is utilised in laboratory research across immunology molecular biology peptide chemistry and cellular signalling disciplines. Researchers apply LL37 to study membrane peptide interactions immune signalling pathway activation and intracellular response mechanisms under controlled laboratory conditions. Additional applications include investigation of epithelial barrier models nucleic acid peptide complex formation and signalling crosstalk between innate immune receptors. These research models support deeper understanding of host defence peptide behaviour and immune system signalling organisation.
Technical Specifications
- Contents: 5mg LL-37
- Form: Lyophilized powder
- Purity: >99% (HPLC Verified)
- Storage: Store between 2°C and 8°C
- Molecular Formula: C₂₁₅H₃₄₄N₆₀O₅₀
- Sequence: [LL-37, 37 aa]
- Peptide Length: 37 Amino-Acids
- pH Range: 5.5-7.4
Note: Reconstitute with Bacteriostatic (BAC) Water 10ml for best results.
Explore Related Research Compounds
Continue exploring currently available BioPlex compounds associated with host-defence peptide biology, immune signalling and cellular-response research.
View KVP 10mg KPV Tripeptide ⟶
View BPC-157 10mg + LL-37 10mg Research Set ⟶
View KLOW 80mg Peptide Blend ⟶
Explore BioPlex Research Information
Use BioPlex educational tools and guidance covering peptide calculations, preparation, reconstitution, classification and storage.
Use the BioPlex Peptide Calculator ⟶
Read the Peptide Calculator Guide ⟶
Read the Peptide Reconstitution Guide ⟶
Explore Peptide Types & Storage Guidance ⟶
Explore Related Research Articles
Continue exploring BioPlex educational resources covering LL-37, host-defence peptides, immune signalling and related peptide research.
Explore Peptide Research Articles & Scientific Study Guides ⟶
Explore Science Research Studies ⟶
Read the Peptide Reconstitution Guide ⟶
Disclaimer

More Ways to Pay — Coming Soon...
Why Thousands Choose BioPlex Peptides..
BioPlex has built its reputation through consistency, transparency and a long term commitment to quality. With peptide sector experience dating back to 2012, we've grown into one of the UK's most trusted research suppliers by focusing on high quality research products, independent verification and customer confidence—not empty marketing claims!
Explore BioPlex Research Collections
Browse research peptides UK, peptide sets, amino acids, SARMs, reconstitution solutions and the complete BioPlex product range.
Top Selling Product of 2026-Klow 80mg
KLOW is an 80mg multi-peptide research blend combining GHK-Cu, BPC-157, TB-500 and KPV. It supports controlled laboratory investigation into cellular signalling, extracellular matrix regulation, peptide interactions, inflammatory markers and coordinated tissue-response pathways.




Klow Stack 80mg
Teslim alım stok durumu yüklenemedi
Your Recently Viewed Products...
Take another look at recently viewed products and continue exploring the BioPlex range.
New Research Arrivals & Liquid Amino-Acid Blends
Latest Articles From BioPlex ...
Research insights, industry updates and practical guidance from BioPlex Peptides.

Discover Our Sister Store — LoveVella
From the BioPlex family, discover LoveVella, our online adult and lifestyle store with thousands of products for women, men and couples. BioPlex customers can enjoy 15% off their LoveVella order.
CODE: BIOPLEXCUSTOMER
View The Sister Store⟶












