LL-37 5mg
(Cathelicidin)

Premium Grade | UK Supply

LL-37 is a peptide research compound studied in laboratory settings for its relevance to host defence peptide biology, innate response pathways, and controlled sequence based investigation. It is commonly examined in structured research models focused on membrane interaction patterns, biochemical signalling behaviour, and comparative peptide mechanism analysis under defined laboratory conditions. Within scientific supply catalogues, LL-37 is valued for in vitro and preclinical research involving pathway observation, marker evaluation, and analytical peptide study design. Its role in research centres on documented laboratory handling, consistent experimental planning, and professional scientific investigation, making it suitable for research environments requiring clear, research focused presentation and dependable peptide supply standards.

Technical Specifications

• Contents: 10mg LL-37
• Form: Lyophilized powder
• Purity: >99% (HPLC Verified)
• Storage: Store between 2°C and 8°C
• Molecular Formula: C₂₁₅H₃₄₄N₆₀O₅₀
• Sequence: [LL-37, 37 aa]
• Peptide Length: 37 Amino-Acids 
• pH Range: 5.5-7.4
• Storage: Store between 2°C and 8°C

Note: Reconstitute with Bacteriostatic (BAC) water for best results.

Related Research Compounds

Mot-c 10mg
ACE-31 1mg
GHK-cu 100mg

Disclaimer

For research purpose only, Not for human consumption.