GDF-8 1mg
(Growth Factor 8)

£79.99 £69.99 Épargnez 13%
Taxes incluses. Frais d'expédition calculés à l'étape de paiement.
5.0

Premium Grade | UK Supply | Research Peptide | COA Certified | >99% Purity | Worldwide Delivery


(Centenonapeptide, 109 amino acids)

 

Brief Summary

GDF-8, also known as myostatin, is a recombinant growth differentiation factor studied in laboratory settings for its role in muscle-cell regulation, myogenic signalling and tissue-development pathways. It belongs to the transforming growth factor beta superfamily and is investigated primarily as a regulatory protein associated with skeletal muscle growth and differentiation. Research has focused particularly on its interaction with activin type II receptors and the downstream SMAD-associated signalling pathways involved in myoblast activity, muscle-fibre development and protein regulation. Within scientific research catalogues, GDF-8 is valued for in vitro and preclinical investigation involving myogenic pathway activity, growth-factor signalling, cellular differentiation and comparative ligand-receptor analysis. Its defined mature protein sequence supports structured laboratory study, analytical characterisation and reproducible growth-factor research within professional scientific environments.

 

Product Overview

GDF-8 is a laboratory-grade recombinant protein developed for controlled research into myostatin signalling, muscle-cell differentiation and transforming growth factor beta pathway activity. The mature GDF-8 protein contains 109 amino acids and forms a disulphide-linked homodimer under biologically active conditions. This dimeric structure allows GDF-8 to interact with activin type II receptors, including ActRIIB, before recruiting associated type I receptors and initiating intracellular signalling. GDF-8 has been examined in myoblast cultures, muscle-cell development models and protein-expression assays involving myogenic regulatory factors. It is particularly relevant to comparative studies involving Follistatin, ACE-031 and other compounds associated with myostatin-pathway regulation. Its defined composition and reproducible molecular characteristics support controlled investigation into receptor binding, cellular differentiation, muscle-associated gene expression and growth-factor communication.

 

Scientific Background

From a molecular science perspective, GDF-8 is studied as a signalling protein that contributes to the regulation of skeletal muscle development. It is synthesised as a larger precursor protein before proteolytic processing releases the mature C-terminal growth-factor domain. Two mature GDF-8 chains form a disulphide-linked homodimer that can bind activin type II receptors on the cellular surface. This interaction supports the recruitment of type I receptors and the activation of SMAD2 and SMAD3-associated intracellular pathways. These signalling events are examined for their relationship with myoblast proliferation, cellular differentiation and muscle-associated protein expression. Laboratory studies also investigate the regulation of GDF-8 through extracellular binding proteins such as Follistatin and natural inhibitory propeptides. GDF-8 therefore provides a useful molecular tool for examining ligand-receptor communication, myogenic pathway regulation and the relationship between extracellular growth factors and muscle-cell responses.

 

Research Applications

GDF-8 is applied in laboratory research across protein science, molecular biology, myogenic pathway investigation and growth-factor regulation. Researchers use the protein to examine activin type II receptor binding, SMAD2 and SMAD3-associated signalling, myoblast differentiation and muscle-cell development under controlled experimental conditions. Additional research applications include analysis of myogenic regulatory proteins, muscle-fibre formation, cellular proliferation markers and comparative evaluation against Follistatin or other myostatin-binding compounds. GDF-8 may also be used to investigate extracellular ligand regulation, receptor activation and the influence of growth-factor concentration on cellular signalling responses. Its mature 109-amino-acid structure supports research into protein processing, homodimer formation, disulphide-bond stabilisation and structure-activity relationships. These applications contribute to a broader understanding of transforming growth factor beta superfamily signalling and the molecular regulation of myogenic cellular pathways. GDF-8 is supplied as a research compound for analytical, in vitro and controlled preclinical investigation only.

 

Technical Specifications

Contents: 1mg GDF-8
Form: Lyophilised powder
Purity: >99% (HPLC Verified)
Molecular Formula: C₅₅₀H₈₂₃N₁₄₇O₁₅₈S₁₂
Molecular Weight: Approximately 12,407 g/mol
Sequence: DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Peptide Length: 109 amino acids
pH Range: 7.0-7.5
Storage: Store between 1°C and 5°C 

Note: Reconstitute with Bacteriostatic Water

 

Explore Related Research Compounds
Continue exploring related laboratory research products from BioPlex Peptides.

View Follistatin 1mg Research Compound ⟶
View ACE-031 1mg Research Compound ⟶
View IGF-1 LR3 1mg Research Compound ⟶

Research Preparation and Storage
Access BioPlex solutions, calculation tools and storage guidance for accurate and consistent laboratory preparation.

View Reconstitution Solutions ⟶
Use the Peptide Reconstitution Calculator ⟶
Read the Peptide Types and Storage Guide ⟶

Explore Related Research Articles
Continue your research with detailed BioPlex articles covering compound structures, scientific mechanisms and laboratory research pathways.

 

Disclaimer

For research purposes only. Not for human consumption

  • 5 stars: 2 (100%)
  • 4 stars: 0 (0%)
  • 3 stars: 0 (0%)
  • 2 stars: 0 (0%)
  • 1 star: 0 (0%)
S
Sergio Moreno

Brought last week and looked everywhere to buy it, the next level in peptides for sure. Waited a few days for delivery-otherwise game changer.

P
Paul Emmits

Arrived yesterday next day delivery as always quick delivery and good products.

More Ways to Pay — Coming Soon...

Why Thousands Choose BioPlex Peptides..

BioPlex has built its reputation through consistency, transparency and a long term commitment to quality. With peptide sector experience dating back to 2012, we've grown into one of the UK's most trusted research suppliers by focusing on high quality research products, independent verification and customer confidence—not empty marketing claims!


Explore BioPlex Research Collections

Browse research peptides UK, peptide sets, amino acids, SARMs, reconstitution solutions and the complete BioPlex product range.

Your Recently Viewed Products...

Take another look at recently viewed products and continue exploring the BioPlex range.

New Research Arrivals & Liquid Amino-Acid Blends

Explore the latest BioPlex Peptides product additions, including our new liquid Amino-Acid research range. This collection features premium grade research compounds developed for controlled laboratory investigation into metabolism, cellular energy, recovery pathways, nutrient cofactors and specialist biochemical study models. Supplied from the UK with worldwide delivery.

Discover Our Sister Store — LoveVella

From the BioPlex family, discover LoveVella, our online adult and lifestyle store with thousands of products for women, men and couples. BioPlex customers can enjoy 15% off their LoveVella order.

CODE: BIOPLEXCUSTOMER

View The Sister Store⟶