




LL-37 5mg(Cathelicidin)
No se pudo cargar la disponibilidad de retiro
Premium Grade | UK Supply | Research Peptide | COA Certified | >99% Purity | Worldwide Delivery
(Heptatriacontapeptide–37 Amino Acids)
Brief Summery
LL-37 is a peptide research compound studied in laboratory settings for its relevance to host defence peptide biology, innate response pathways, and controlled sequence based investigation. It is commonly examined in structured research models focused on membrane interaction patterns, biochemical signalling behaviour, and comparative peptide mechanism analysis under defined laboratory conditions. Within scientific supply catalogues, LL-37 is valued for in vitro and preclinical research involving pathway observation, marker evaluation, and analytical peptide study design.
Product Overview
LL37 is a cationic host defence peptide examined extensively in laboratory research for its role in innate immune signalling membrane interaction dynamics and cellular communication processes. It is derived from the C terminal region of the human cathelicidin antimicrobial protein and is studied for its ability to interact with lipid membranes nucleic acids and intracellular signalling systems. Due to its amphipathic structure and well defined molecular behaviour LL37 serves as a key research tool for investigating peptide mediated immune signalling barrier function and cellular response coordination within controlled experimental models.
Scientific Background
From a molecular science perspective LL37 is characterised by its alpha helical structure and positive charge distribution which facilitate interaction with negatively charged membrane components. Research focuses on how LL37 associates with phospholipid bilayers modulates membrane permeability and influences intracellular signalling cascades following membrane engagement. LL37 is also studied for its interaction with nucleic acid complexes and pattern recognition receptor pathways which contribute to immune signal modulation and transcriptional response regulation. These properties allow researchers to examine peptide driven signalling integration membrane associated communication and innate immune pathway coordination at the cellular level.
Research Applications
LL37 is utilised in laboratory research across immunology molecular biology peptide chemistry and cellular signalling disciplines. Researchers apply LL37 to study membrane peptide interactions immune signalling pathway activation and intracellular response mechanisms under controlled laboratory conditions. Additional applications include investigation of epithelial barrier models nucleic acid peptide complex formation and signalling crosstalk between innate immune receptors. These research models support deeper understanding of host defence peptide behaviour and immune system signalling organisation.
Technical Specifications
- Contents: 5mg LL-37
- Form: Lyophilized powder
- Purity: >99% (HPLC Verified)
- Storage: Store between 2°C and 8°C
- Molecular Formula: C₂₁₅H₃₄₄N₆₀O₅₀
- Sequence: [LL-37, 37 aa]
- Peptide Length: 37 Amino-Acids
- pH Range: 5.5-7.4
Note: Reconstitute with Bacteriostatic (BAC) water for best results.
Related Research Compounds
Mot-c 10mg
ACE-031 1mg
GHK-cu 100mg
Disclaimer

Pay With "Wise"
Set Up Wise Here-Works Just Like PayPal. Just Add Your card And Pay In Minutes... Great For International Payments!
Your Recently Viewed Products...
Take another look at recently viewed products and continue exploring the BioPlex range.
New Research Arrivals & Liquid Amino-Acid Blends
Product Information
Specifications, shipping & research guidelines
Laboratory Research Use
This product is supplied for laboratory research and analytical purposes only, supporting structured investigation within controlled scientific environments.
Product Specifications
Form: Lyophilised powder
Purity: >99% (HPLC Verified)
Storage: 2°C to 8°C
Shipping Information
UK 24hr shipping Worldwide 48hr Shipping via DHL Express. Orders are dispatched Monday to Thursday using tracked delivery services.
Latest Articles From BioPlex ...
Research insights, industry updates and practical guidance from BioPlex Peptides.










